Protein Info for CSW01_06570 in Vibrio cholerae E7946 ATCC 55056

Annotation: serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF01490: Aa_trans" amino acids 25 to 415 (391 residues), 30.6 bits, see alignment E=7.2e-12

Best Hits

KEGG orthology group: K03837, serine transporter (inferred from 100% identity to vco:VC0395_A0919)

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>CSW01_06570 serine transporter (Vibrio cholerae E7946 ATCC 55056)
MNTTTAATSTARSASKWTYKDFTWALSLFGTAVGAGVLFLPIKAGAGGFWPLVLLALIAA
PMTWFAHKSLARFVLSAKNPDADITDTVEEHFGKAGANLITFAYFFAIYPIVLIYGVGIT
NTVDSFLVNQIGMESIPRWLLSGALITAMTAGVVFGKELMLKATSAMVYPLVFILLALSF
YLIPDWNTSMMEVAPDWSAMPAIVWLAIPIIVFSFNHSPIISQFSKEQRQQFGDKAVQKT
DMITGGAAMMLMGFVMFFVFSVVLSLSPAELAMAKEQNISVLSYLANEHASPIISYLGPI
VAFAAITSSYFGHFLGAHEGLVGLVKSRSNMQVSKIEKISLGFIVITTWIVAIVNPSILG
MIETMGAPMIAAILFLLPVFAMHKVPAMAKFKTSAPVQIFTVICGLAAISSVIYGAL