Protein Info for CSW01_06560 in Vibrio cholerae E7946 ATCC 55056

Annotation: 6-carboxytetrahydropterin synthase QueD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR03367: queuosine biosynthesis protein QueD" amino acids 6 to 98 (93 residues), 111.6 bits, see alignment E=9.3e-37 PF01242: PTPS" amino acids 6 to 122 (117 residues), 129.6 bits, see alignment E=3.1e-42

Best Hits

Swiss-Prot: 79% identical to QUED_ECO57: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Escherichia coli O157:H7

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 100% identity to vch:VC1299)

MetaCyc: 79% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>CSW01_06560 6-carboxytetrahydropterin synthase QueD (Vibrio cholerae E7946 ATCC 55056)
MMMKTELYKEFMFEAAHHLPHVPAGHKCGRLHGHSFLVRLYVEGEVDPHTGWVVDFAEIK
AAFKPIYDRLDHYYLNDIEGLENPTSEVLAKWIWQQLKPSLPLLSKVEIKETCTAGCIYR
GE