Protein Info for CSW01_06545 in Vibrio cholerae E7946 ATCC 55056

Annotation: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 12 to 269 (258 residues), 328.8 bits, see alignment E=9.9e-103 PF08543: Phos_pyr_kin" amino acids 19 to 267 (249 residues), 319.6 bits, see alignment E=1.3e-99 PF00294: PfkB" amino acids 111 to 243 (133 residues), 27.3 bits, see alignment E=2.2e-10

Best Hits

Swiss-Prot: 49% identical to THID_ECOLI: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Escherichia coli (strain K12)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 100% identity to vch:VC1296)

MetaCyc: 49% identical to bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Escherichia coli K-12 substr. MG1655)
Phosphomethylpyrimidine kinase. [EC: 2.7.4.7]; Hydroxymethylpyrimidine kinase. [EC: 2.7.4.7, 2.7.1.49]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>CSW01_06545 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Vibrio cholerae E7946 ATCC 55056)
MSIISSIHTPIVLTIAGSDSGGGAGIQADIKAISATGGYACSVITAITAQNTQGVSAVFP
LPLAVVEQQLDAVFSDIPVLAVKIGMLADAPIIALVAKKLRQYQPKWIVLDPVMISTSGH
HLLAAEAVETLKRELLPLANLITPNLPEAAVLAGMTQQEWQQNPQQGITVLSQLNTPAVL
LKGGHDHQQANSDDLLIQSGDSRHFCAPRIATKNTHGTGCSLSSAIASYLAQGAELVEAV
DKAKQYIHQAIVHADQLRIGQGYGPIHHFYLLQMAKSQQKSQ