Protein Info for CSW01_06525 in Vibrio cholerae E7946 ATCC 55056

Annotation: cyclic nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF00027: cNMP_binding" amino acids 45 to 126 (82 residues), 50.9 bits, see alignment E=2.6e-17 PF00571: CBS" amino acids 160 to 223 (64 residues), 29.4 bits, see alignment E=1.6e-10 amino acids 234 to 286 (53 residues), 43.6 bits, see alignment 6.1e-15 PF03445: DUF294" amino acids 313 to 450 (138 residues), 159.6 bits, see alignment E=8.7e-51 PF10335: DUF294_C" amino acids 486 to 630 (145 residues), 153.3 bits, see alignment E=8.3e-49

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to vcj:VCD_003059)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>CSW01_06525 cyclic nucleotide-binding protein (Vibrio cholerae E7946 ATCC 55056)
MFVTIGASMDAELIEIQQFLQQHPPFDALPNERLPEIAQQIEIAYFRKDTPIIGYKQAIS
DLYLVRSGAVEVYRRHGELYNRLTEGSLFGQMGLLTRNQVSFAVTAIEDTLLYCLPEALF
HRLHQEFDSFADFVEVEQAVRLRQTVAKQKEQNDLITSKVKQLLTRSAPTIDKQASIQQA
AQRMADENVSALLILDNQILLDTEDDSTPMVGIVTERDLCRRVLAQGMDVTQTVSQVMTH
EVISLDHNAYVYEAMLAMLRNNVHHLPVLRERQPIGIIDMTDIVRHESQNSLLLVSRIYQ
QTCIDDLAQLANEVKASFVRLVNEDANSHMIGTAMSTIGRAFTQRIIELVEAELGAAPLP
YCFVAFGSMGRDEQLIVTDQDNALILDDRYDVQQHGAYFAQFAELVCRGLDRCGYPLCDG
EIMASNPKWRMTRKEWETCFADWIDNPNPQALLNASIFFDLDGVYGRTKWAEQLSGFIVR
RARRNQRFLACLARNALNRTPPLGFFKNFVMEKDGRHNNSINLKRRGTAPLADLIRVHAL
AAGSRAKNSFERLDDVIEAGLLPQGKGKDLRDALEFIAMVRIRHQAIDVEQEREADNSIE
PEHLSDFERRNLKDAFQILSNGQNYLKYRYQANQHFK