Protein Info for CSW01_06460 in Vibrio cholerae E7946 ATCC 55056

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF22381: Staph_reg_Sar_Rot" amino acids 23 to 102 (80 residues), 42.1 bits, see alignment E=2.3e-14 PF12802: MarR_2" amino acids 30 to 88 (59 residues), 51.7 bits, see alignment E=2.4e-17 PF01047: MarR" amino acids 31 to 90 (60 residues), 53.7 bits, see alignment E=4.8e-18 PF13463: HTH_27" amino acids 31 to 98 (68 residues), 37.5 bits, see alignment E=7e-13 PF09339: HTH_IclR" amino acids 39 to 81 (43 residues), 23.6 bits, see alignment E=1e-08 PF13412: HTH_24" amino acids 49 to 79 (31 residues), 26.6 bits, see alignment 1.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_003072)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>CSW01_06460 MarR family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MEKHEEVLVALRQIIRAIDLHSKKLNKDAGLTGPQLILMRSIHDLGEQVTIRELAVHTNM
SQGTATTILDRLERNGYVQRVRSNSDKRKVHAHLTDEGRKLLAQAPQPLQESFVEQFHQL
QDWEQSLLLSSVQRISAMMNAQDMDAAPMLTIGSITQPE