Protein Info for CSW01_06245 in Vibrio cholerae E7946 ATCC 55056

Annotation: L-cystine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 273 to 298 (26 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details PF00375: SDF" amino acids 43 to 455 (413 residues), 345.6 bits, see alignment E=1.9e-107

Best Hits

Swiss-Prot: 56% identical to Y1154_HAEIN: Uncharacterized symporter HI_1154 (HI_1154) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06956, (no description) (inferred from 100% identity to vch:VC1235)

Predicted SEED Role

"L-cystine uptake protein TcyP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>CSW01_06245 L-cystine transporter (Vibrio cholerae E7946 ATCC 55056)
MAVVTLLPPFKDLLMSVVTLAALVIFAGLLLYLFGLQKKAATLSRQVLFGLVLGSAFGLA
LQVVLGEGHPAIQETLSWVAIVGNGYVGLLKMVIMPLVLVSMISAVVRLDKNGSLGKISS
LTIGILLVTTAISALIGILITQAFGLTAEGLVEGARETARIAALESRASTVADLTIPQIL
LSFIPTNPFADLTGARSTSIIAVVIFGVLTGIAARKVIADKQELETPIRTFVEAAQAIVM
RLVKMIMALTPYGIAALMAKVVATSSATDILNLLGFIVASYVAIALMFVVHGLLVAMVGV
NPTRYFKNIWPVLTFAFTSRSSAATIPLNVEAQITKLNVPPAIANLSASFGATIGQNGCA
GIYPAMLAVMVAPTVGINPLDIHFIVSLIAMITISSFGIAGVGGGATFAALIVLPAMGLP
VTIAALLISIEPLIDMARTALNVSGSMTAGTVTSRLLKETNEEPEPQTQQA