Protein Info for CSW01_06220 in Vibrio cholerae E7946 ATCC 55056

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 142 to 284 (143 residues), 42 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to vch:VC1229)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>CSW01_06220 AEC family transporter (Vibrio cholerae E7946 ATCC 55056)
MFEQIIAILFPVMSLVLIGYLIGLWLKPDFRPINRINMEAFVPALVFSSLVNMPLDTQQT
PLLLAALVAVLLPGILMLLICRLGRWSFKTWAPLHMFRNSGNLAIPLFTYAFGETALPSA
VLLFVVSMCLHISLGVAMLSKGSVLKTVLSAPVFLASSLALLLNLSGVSIWSPLYNATAL
LGQAAVPVMLLSLGSQMINLRLAGLKVGLVSTAQSLLTGACAFTVIYFFIPLPPLQLQMM
VLFTMLPPAVMNYLFAERYHIEPTQVAAMVLFGNFFSLLSLPILLFIALSL