Protein Info for CSW01_06175 in Vibrio cholerae E7946 ATCC 55056

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF13673: Acetyltransf_10" amino acids 43 to 143 (101 residues), 37.5 bits, see alignment E=4.3e-13 PF00583: Acetyltransf_1" amino acids 46 to 137 (92 residues), 67.4 bits, see alignment E=2.7e-22 PF13420: Acetyltransf_4" amino acids 50 to 140 (91 residues), 28.6 bits, see alignment E=2.6e-10 PF13508: Acetyltransf_7" amino acids 53 to 138 (86 residues), 59.1 bits, see alignment E=9.3e-20

Best Hits

Swiss-Prot: 41% identical to YJGM_SALTY: Uncharacterized N-acetyltransferase YjgM (yjgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to vcj:VCD_003127)

MetaCyc: 41% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>CSW01_06175 N-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MRVEIVPIRPEFDAEICQIIQSVGAEFGAIGEGFGPSDAEVLAMSQYYREQDRSAYFVAL
LEGKVVGGGGIAPFAGHTDLCELKKLFLLPTSRGHGVGRALSEHCLNFAKQQGYTKCYLD
TLSSMTQAIKLYQQLGFEHLTQPMAGTEHNGCDVWMLKSLN