Protein Info for CSW01_06070 in Vibrio cholerae E7946 ATCC 55056

Annotation: serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 376 to 397 (22 residues), see Phobius details PF00089: Trypsin" amino acids 33 to 263 (231 residues), 174.4 bits, see alignment E=4.8e-55 PF13365: Trypsin_2" amino acids 66 to 231 (166 residues), 28.9 bits, see alignment E=2.6e-10 PF22544: HYDIN_VesB_CFA65-like_Ig" amino acids 269 to 369 (101 residues), 61.5 bits, see alignment E=1.1e-20 TIGR03501: GlyGly-CTERM domain" amino acids 381 to 401 (21 residues), 23.9 bits, see alignment (E = 2.4e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1155)

Predicted SEED Role

"Secreted trypsin-like serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>CSW01_06070 serine protease (Vibrio cholerae E7946 ATCC 55056)
MHQVSKLLSCFIGFSLFSTLLYAESTADISSRIINGSNANSAEWPSIVALVKRGADAYQG
QFCGGSFLGGRYVLTAAHCFDSRSAASVDVIIGAYDLNNSSQGERIAAQKIYRHLSYSPS
NLLNDIAIVELAQTSSLPAITLAGPATRTSLPALTPLTVAGWGITVQSKPPQFTPILQEV
DVDLVSQSLCQIVMQHGISSDPNSTNFCAARLTKDSCQGDSGGPIVVKTGREQLGIVSWG
DEQCAKTGTYGVYTNVSYFRDWITKHTNQLSYDQVANLGIRPLGKVSQSFTYTNLDANAL
TYTGNTFSSLPADFSVLSDGCSTKVTLATGESCSVEVAVDAQHYRQYQYDFELIFSYAGG
SKRATSRIQLDTSPFAPSASSGGSIGWFGLLLLAPLWMRRKTA