Protein Info for CSW01_05945 in Vibrio cholerae E7946 ATCC 55056

Annotation: type 1 glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 6 to 189 (184 residues), 178.9 bits, see alignment E=4.7e-57 PF00117: GATase" amino acids 8 to 188 (181 residues), 172.5 bits, see alignment E=8.2e-55 PF07722: Peptidase_C26" amino acids 75 to 174 (100 residues), 23.3 bits, see alignment E=4.9e-09

Best Hits

Swiss-Prot: 100% identical to TRPG_VIBCH: Anthranilate synthase component 2 (trpG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 100% identity to vcj:VCD_003170)

MetaCyc: 46% identical to PhnB anthranilate synthase subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>CSW01_05945 type 1 glutamine amidotransferase (Vibrio cholerae E7946 ATCC 55056)
MIMANILFIDNFDSFTYNLVDQFRSLGHVVTIYRNNLSADAIEQALLQLDNPVVVLSPGP
GAPSETGCMPELLQRLKGKVPMIGICLGHQAIVEAYGGVVAGAGEIIHGKVSMMEHQNHA
IYRGLPSPLAIARYHSLVATQVPSALTVTAEVNGLVMSVVNEADKVCGFQFHPESIMTTH
GATLLANAIDWALSSTPAQTQFA