Protein Info for CSW01_05850 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA transformation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF04993: TfoX_N" amino acids 16 to 106 (91 residues), 80.3 bits, see alignment E=9.2e-27 PF04994: TfoX_C" amino acids 119 to 197 (79 residues), 101.1 bits, see alignment E=3.1e-33

Best Hits

Swiss-Prot: 59% identical to TFOX_ALIF1: DNA transformation protein TfoX1 (tfoX1) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K07343, DNA transformation protein and related proteins (inferred from 100% identity to vcm:VCM66_1109)

Predicted SEED Role

"Regulator of competence-specific genes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>CSW01_05850 DNA transformation protein (Vibrio cholerae E7946 ATCC 55056)
MIKGSMDMNEQQFFDYVTKFGAYQKRSMFGGIGLFQHDAMYVLVSEDRIFVRGGEELDPE
LLALGCEKYRHVKKQTTATVNYYDITELYEQHHPELDSIIERSIQFSVNQREFQRSAASR
RLRDLPNMQLTLERMVKKAGIDDVETFMSLGAPEVFNKVRQAYGSDVDVKLLWKFAGAIE
GIHWKLLQEPRKRQLLESCQQR