Protein Info for CSW01_05775 in Vibrio cholerae E7946 ATCC 55056

Annotation: imidazole glycerol phosphate synthase cyclase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 256 (256 residues), 380.6 bits, E=1.6e-118
• PF00977: His_biosynth
  • amino acids 5 to 239 (235 residues), 253.1 bits, E=3.5e-79
• PF01207: Dus
  • amino acids 32 to 114 (83 residues), 22.9 bits, E=6.7e-09
• PF05690: ThiG
  • amino acids 35 to 121 (87 residues), 23.6 bits, E=4.7e-09

Best Hits

Swiss-Prot: 100% identical to HIS6_VIBCH: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 100% identity to vch:VC1138)

MetaCyc: 86% identical to imidazole glycerol phosphate synthase subunit HisF (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Protein Sequence (257 amino acids)

>CSW01_05775 imidazole glycerol phosphate synthase cyclase subunit (Vibrio cholerae E7946 ATCC 55056)
MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV
VDKSWVARVAEVIDIPFCVAGGIKSAQDAARILEFGADKVSINSPALANPQLITDLADRF
GVQCIVVGIDSYFDKETGQYQVYQFTGDESRTRATQWQTCDWVQEVQKRGAGEIVLNMMN
QDGVRNGYDLEQLNLVRSVCRVPLIASGGAGAMEHFAQAFTQANVDGALAASVFHKQIIN
IGELKQYLKQQGIEVRR