Protein Info for CSW01_05745 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR00070: ATP phosphoribosyltransferase" amino acids 6 to 196 (191 residues), 186.6 bits, see alignment E=3.9e-59 PF01634: HisG" amino acids 53 to 217 (165 residues), 164.6 bits, see alignment E=1.8e-52 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 203 to 297 (95 residues), 98.9 bits, see alignment E=1.6e-32 PF08029: HisG_C" amino acids 222 to 295 (74 residues), 82.9 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 100% identical to HIS1_VIBCH: ATP phosphoribosyltransferase (hisG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to vcm:VCM66_1088)

MetaCyc: 68% identical to ATP phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
ATP phosphoribosyltransferase. [EC: 2.4.2.17]

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>CSW01_05745 ATP phosphoribosyltransferase (Vibrio cholerae E7946 ATCC 55056)
MQTQRLRIAIQKKGRLSQECQELLKKCGVKFNIMGERLVVHSLNMPIDLLLVRDDDIPGL
IMDGVVDLGFVGENVLEETRLDRLALNQRNEFTTLRRMDFGGCRLSIAIEKDAEYRGPQD
LNGKRIATTYPQLLKAYMDRQGVDFSTCMLTGSVEVAPRAGLADAIADLVSTGATLEANG
LKEVEVIFESKATLIQRPGAFAADKAALIDKLLTRMHGVQQAKESKYIMLHAPVEKLAQI
KTLLPGAEDPTVLPLSADKSKVAVHMVSSENLFWETMEQLKALGASSILVLPIEKMME