Protein Info for CSW01_05740 in Vibrio cholerae E7946 ATCC 55056

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 393 to 418 (26 residues), see Phobius details amino acids 430 to 448 (19 residues), see Phobius details amino acids 480 to 522 (43 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 165 to 497 (333 residues), 315.1 bits, see alignment E=2.5e-98

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1087)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>CSW01_05740 Na+/H+ antiporter (Vibrio cholerae E7946 ATCC 55056)
MNLIDFASSPLSVLPPLVALSLAIVTRRVLLSLGVGIFLGALLLADYSIGQSLQYIATQV
GSVFVKEGAINAWNMSIVGFLLLLGMMTALLTLSGGTRAFAQWAQVRVKSKRGSKLLAAF
LGVFIFVDDYFNSLAVGSISRPVTDRFYVSRAKLAYILDSTAAPMCVVMPASSWGAYIMT
IIGGILVSHGIEEYSALGAYLRLVPMNFYAIFALLMVFAVVWFQMDIGQMRKHEIAASQG
RGFDEDPSTDTQEAHELNEELDIRESERGTVLDLVLPIVFLVVATIGAMIWTGASALAES
GQSFDIFGAFENTNVGTSLVYGGLVGLAMAFVTVLRQKLPTAEIAKTLWIGAKSMFGAIL
ILIFAWTIGSVIGDMKTGAYLSSLVQGNIDPHWLPVILFVLSGAMAFSTGTSWGTFGIML
PIAGDMAGATDIALMLPMLGAVLAGSVFGDHCSPISDTTILSSTGARCHHIDHVATQLPY
ALAVALVSAIGYVVLGIFASLGLALAAASVSFVVVCLIFAALSKAKVSKQVSA