Protein Info for CSW01_05630 in Vibrio cholerae E7946 ATCC 55056

Annotation: replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF05496: RuvB_N" amino acids 21 to 139 (119 residues), 50.7 bits, see alignment E=7.3e-17 PF07728: AAA_5" amino acids 54 to 156 (103 residues), 25.7 bits, see alignment E=4.2e-09 PF00004: AAA" amino acids 54 to 159 (106 residues), 66.8 bits, see alignment E=1.1e-21 PF13173: AAA_14" amino acids 54 to 172 (119 residues), 27.6 bits, see alignment E=1e-09 PF16193: AAA_assoc_2" amino acids 192 to 268 (77 residues), 76.3 bits, see alignment E=7.5e-25 PF12002: MgsA_C" amino acids 269 to 435 (167 residues), 221.9 bits, see alignment E=2e-69

Best Hits

Swiss-Prot: 74% identical to RARA_ECOL6: Replication-associated recombination protein A (rarA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to vcj:VCD_003233)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>CSW01_05630 replication-associated recombination protein A (Vibrio cholerae E7946 ATCC 55056)
MSNYSLDFSGDEDFRPLAARMRPQTVEQYIGQQHILGPGKPLRRALEAGHIHSMILWGPP
GTGKTTLAEVAANYANAEVERVSAVTSGVKEIRAAIEKARENKLSGRRTILFVDEVHRFN
KSQQDAFLPHIEDGTVTFIGATTENPSFELNNALLSRARVYKLTSLNQQEILQALHQAIA
DTERGLGKVAAVFADNVLDRLAELVNGDARMSLNYLELLYDMAREDDQGRKQIDLPLLAE
VAGEKVSRFDNKGDIWYDLISAVHKSIRGSDPDAALYWAARMISAGCDPLYIARRLLAIA
SEDVGNADPRGMQVALAAWDCFTRVGPAEGERAIAQAIVYLACAPKSNAVYTAWKQALSD
AHNLPEFEVPPHLRNAPTRLMKDLGYGEEYRYAHDEPGAYAAGECYFPPEMSGTRYYQPT
PRGLETKIAEKLAYLADLNAKSPQKRYEK