Protein Info for CSW01_05620 in Vibrio cholerae E7946 ATCC 55056

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02810: SEC-C" amino acids 191 to 208 (18 residues), 35.9 bits, see alignment (E = 2.8e-13)

Best Hits

KEGG orthology group: K07039, uncharacterized protein (inferred from 100% identity to vch:VC1106)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>CSW01_05620 prepilin peptidase (Vibrio cholerae E7946 ATCC 55056)
MFPMNYSLIDLSAIECPESDLFIEGVVLAANLATRPLDPEQWLPELFTEQHQALLQPVTE
QIHRQYQLLKGNGYDLLALLAEHAPSRKQGLADFAEGFMQLWPQVEPMWQQGAFADGSIR
MLQALLTTLMLAIDEAQTQAQMREAGYEQVPALADLIEQLNLMVHEVALAADEAMLGAKA
QSVNPFKGIGRNDACPCDSGKKFKQCCGQ