Protein Info for CSW01_05570 in Vibrio cholerae E7946 ATCC 55056

Annotation: glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF13409: GST_N_2" amino acids 56 to 146 (91 residues), 44.7 bits, see alignment E=3.5e-15 PF00043: GST_C" amino acids 188 to 267 (80 residues), 30.9 bits, see alignment E=5.3e-11 PF13410: GST_C_2" amino acids 191 to 263 (73 residues), 61.3 bits, see alignment E=1.5e-20 PF14497: GST_C_3" amino acids 193 to 273 (81 residues), 24.4 bits, see alignment E=5.6e-09

Best Hits

Swiss-Prot: 58% identical to YQJG_ECOLI: Glutathionyl-hydroquinone reductase YqjG (yqjG) from Escherichia coli (strain K12)

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 100% identity to vch:VC1096)

MetaCyc: 58% identical to glutathionyl-hydroquinone reductase YqjG (Escherichia coli K-12 substr. MG1655)
RXN0-7010 [EC: 1.8.5.7]

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 1.8.5.7 or 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>CSW01_05570 glutathione S-transferase family protein (Vibrio cholerae E7946 ATCC 55056)
MGKLIKGKWHDVWYDTKQHDGEFIREDAGFRDWVKATPDAQFAAESGRYHLYVSLACPWA
HRTLIFRALKGLQTHIDVTIVCPDMLSHGWQFGIPEPLYGYTQLHQLYTHAKADYTGRVT
VPVLWDKKLHTIVSNESSEIIRMFNSAFNELTGNQTDYYPQALRTVIDEWNEFIYPNINN
GVYRCGFATTQKAYEEAFEALFAALDKVDQHLTTHRYLAGNQITEADWRLFTTLVRFDAV
YVGHFKCNRQRITDYPHLSGYLRELYQVPGIQETVDFYHIKRHYYFSHTTINPTQVVPVG
PQVDLLSPHQRERIG