Protein Info for CSW01_05550 in Vibrio cholerae E7946 ATCC 55056

Annotation: oligopeptide ABC transporter permease OppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 274 to 300 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 74 (74 residues), 42 bits, see alignment E=9.5e-15 PF00528: BPD_transp_1" amino acids 112 to 305 (194 residues), 141.4 bits, see alignment E=2.9e-45

Best Hits

Swiss-Prot: 68% identical to OPPB_ECOL6: Oligopeptide transport system permease protein OppB (oppB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to vcm:VCM66_1048)

MetaCyc: 68% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>CSW01_05550 oligopeptide ABC transporter permease OppB (Vibrio cholerae E7946 ATCC 55056)
MLKFIAKRIFEAIPTMLVLITISFFLMRYAPGNPFSSERPLPPEVMANINAKYGLDKPVS
EQYLTYLTNIVQGDFGPSFKYKDYTVNELIASALPVSVKIGLAAFVFTVIMGVTVGTIAA
LKQNTWIDYTIMSTAMLGVVMPSFVLAPVLIYIFAIQFSLFPAGGWQDGGFEYMALPVLG
MSLLYVATFARITRGSMIETLNSNFIRTARAKGLSYGYIVVKHALKPALLPVVSYMGPAF
VGIITGSVVIETIFGLPGIGKLFVNAAFNRDYSLVMGVTILIGFLFILFNAIVDILLAYI
DPKIRY