Protein Info for CSW01_05395 in Vibrio cholerae E7946 ATCC 55056

Annotation: protease SohB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 195 to 209 (15 residues), see Phobius details PF08496: Peptidase_S49_N" amino acids 2 to 162 (161 residues), 180.7 bits, see alignment E=1.9e-57 PF01343: Peptidase_S49" amino acids 165 to 313 (149 residues), 163.3 bits, see alignment E=4.2e-52

Best Hits

KEGG orthology group: K04774, serine protease SohB [EC: 3.4.21.-] (inferred from 100% identity to vcm:VCM66_1015)

Predicted SEED Role

"Possible protease sohB (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>CSW01_05395 protease SohB (Vibrio cholerae E7946 ATCC 55056)
MEFLLDYGLFLAKIVTVVVALVAVLVIVKSLGGRSGGAKGELEITDLTEQHKETVERLEA
YLHDEAFLKARDKADKKKEKAEQKSREKSLKQAAKEGELESKRDPHLFVLDFHGSIDAKE
VASLREEVSAILAVAQAGDEVLLRLETGGGMVHGYGLASSQLDRLKAAGLPLTIAVDKVA
ASGGYMMACIADKIVSAPFAIVGSIGVVAQLPNFHKLLKKNDIEFEQLTAGEYKRTLTMF
GENTDKAREKFKQELEETHQLFKDFIREHRPALDLDKVATGEHWFGTQAKALGLVDEIQT
SDDLIVAACKSKTVLLLRYTQKKKLADKLAGVAGDAADNVLLKLISRGQRPLV