Protein Info for CSW01_05370 in Vibrio cholerae E7946 ATCC 55056

Annotation: YbaB/EbfC family nucleoid-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 1 to 105 (105 residues), 131.5 bits, see alignment E=6e-43 PF02575: YbaB_DNA_bd" amino acids 11 to 100 (90 residues), 122.4 bits, see alignment E=3.6e-40

Best Hits

Swiss-Prot: 100% identical to Y1055_VIBCH: Nucleoid-associated protein VC_1055 (VC_1055) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K09747, hypothetical protein (inferred from 95% identity to vvu:VV1_2004)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>CSW01_05370 YbaB/EbfC family nucleoid-associated protein (Vibrio cholerae E7946 ATCC 55056)
MFGKGGMGNLMKQAQQMQERMQKLQEEIANMEVTGESGAGLVKVTVTGSHSVRRVNIDES
LMEDDKEMLEDLIAAAFNDAARRIEETQKEKMASITGGMQLPPGMKMPF