Protein Info for CSW01_05290 in Vibrio cholerae E7946 ATCC 55056

Annotation: cob(I)yrinic acid a,c-diamide adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12557: Co_AT_N
  • amino acids 7 to 26 (20 residues), 27.3 bits, see alignment (E = 2.7e-10)
• TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase
  • amino acids 29 to 201 (173 residues), 237.7 bits, E=3.6e-75
• PF02572: CobA_CobO_BtuR
  • amino acids 32 to 201 (170 residues), 214 bits, E=1.8e-67

Best Hits

Swiss-Prot: 67% identical to BTUR_ECOLI: Corrinoid adenosyltransferase (btuR) from Escherichia coli (strain K12)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 100% identity to vco:VC0395_A0558)

MetaCyc: 66% identical to cob(I)yrinic acid a,c-diamide adenosyltransferase subunit (Salmonella enterica enterica serovar Typhimurium)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]; 2.5.1.17 [EC: 2.5.1.17]; 2.5.1.17 [EC: 2.5.1.17]

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (18/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (18/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Protein Sequence (201 amino acids)

>CSW01_05290 cob(I)yrinic acid a,c-diamide adenosyltransferase (Vibrio cholerae E7946 ATCC 55056)
MSGDEIKQERHKARQQKVKEQVDAKIAAAQEEKGLLLIITGNGKGKSTSGFGTIARAVGH
GKQCAVVQFIKGTWENGERNLLEKLGVEFQVMSTGFTWETQNRDSDTAAAQEVWQHCKRM
LQDESLDVVLFDELTYMVSYGYIELDEVVEALNQRPKMQSVIITGRGAHRTLIEMADTVS
EVKNIKHAFESGVKALKGVDW