Protein Info for CSW01_05125 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribonuclease T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR01298: ribonuclease T" amino acids 29 to 228 (200 residues), 327.5 bits, see alignment E=1.5e-102 PF00929: RNase_T" amino acids 39 to 214 (176 residues), 85.2 bits, see alignment E=7.8e-28 PF16473: Rv2179c-like" amino acids 39 to 217 (179 residues), 28.5 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 100% identical to RNT_VIBCH: Ribonuclease T (rnt) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 100% identity to vco:VC0395_A0527)

MetaCyc: 69% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>CSW01_05125 ribonuclease T (Vibrio cholerae E7946 ATCC 55056)
MLYRRICNNASLITQFRTRMTDKNDALTLKKRFRGYFPVVIDVETAGFNAQTDALLEICA
VTLSMDENGDLHPASTIHFHVEPFEGANLEKAALEFTGIYDPFSPLRGAVSEDHALKEIY
KLVRKEQKAADCSRAIIVAHNAHFDHSFVMAASERCKLKRVPFHPFATFDTATLSGLAFG
QTVLAKACKTAGMEFDNREAHSALYDTQKTAELFCTIVNQWKALGGWPLVNDDEDNNNDA
DLD