Protein Info for CSW01_05115 in Vibrio cholerae E7946 ATCC 55056

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 TIGR01134: amidophosphoribosyltransferase" amino acids 2 to 463 (462 residues), 549.6 bits, see alignment E=3.7e-169 PF13230: GATase_4" amino acids 63 to 173 (111 residues), 25.3 bits, see alignment E=1.4e-09 PF13522: GATase_6" amino acids 64 to 194 (131 residues), 61.9 bits, see alignment E=1.3e-20 PF13537: GATase_7" amino acids 80 to 212 (133 residues), 52 bits, see alignment E=1.4e-17 PF00156: Pribosyltran" amino acids 286 to 391 (106 residues), 27.4 bits, see alignment E=4e-10

Best Hits

Swiss-Prot: 76% identical to PUR1_ECOLI: Amidophosphoribosyltransferase (purF) from Escherichia coli (strain K12)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to vco:VC0395_A0525)

MetaCyc: 76% identical to amidophosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Amidophosphoribosyltransferase. [EC: 2.4.2.14]

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>CSW01_05115 amidophosphoribosyltransferase (Vibrio cholerae E7946 ATCC 55056)
MCGIVGIVGTTPVNQSIYDALTVLQHRGQDAAGICTIESNRFRLRKANGLVRDVFEAKHM
QRLQGNVGIGHVRYPTAGSSSASEAQPFYVNSPFGITLAHNGNLTNANQVRQKLFEKDRR
HVNTTSDSEVLLNVLAHEIDTVKGNVTADDVFRAISNVHRTIRGAYAVAAMIIGHGMIAF
RDPHGIRPLCLGKREVNGQLEYMVASESVALDAVGFDFVRDVAPGEAIYATFDGELYTKQ
CADNPALNPCIFEFVYFARPDSFIDKISVYSARVEMGKRLGERIKNDYSDLDIDVVIPIP
ETSCDIALQIAQAIDKPYRQGFVKNRYVGRTFIMPGQQQRKKSVRRKLNAIRSEFKDKNV
LLVDDSIVRGTTSEQIIEMARDSGAKKVYIVSAAPEIRFPNVYGIDMPSANELIAHGRDN
DAICKQIGADALIFQTLEDLVEAVRCGNPDIVKFEASVFNGEYVTGDIDQQYLDFLESMR
SDDAKVQREIQQDLANLELHNEGA