Protein Info for CSW01_05040 in Vibrio cholerae E7946 ATCC 55056

Annotation: ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR00109: ferrochelatase" amino acids 8 to 321 (314 residues), 356.4 bits, see alignment E=8.3e-111 PF00762: Ferrochelatase" amino acids 10 to 321 (312 residues), 386.7 bits, see alignment E=7.3e-120

Best Hits

Swiss-Prot: 100% identical to HEMH_VIBCH: Ferrochelatase (hemH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01772, ferrochelatase [EC: 4.99.1.1] (inferred from 100% identity to vcj:VCD_003351)

MetaCyc: 60% identical to ferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrochelatase, protoheme ferro-lyase (EC 4.99.1.1)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.99.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1 or 4.99.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>CSW01_05040 ferrochelatase (Vibrio cholerae E7946 ATCC 55056)
MKEAMNNHKKLGILLANLGTPQAPTSQAVKAFLSQFLHDQRVVDMSRWLWCPLLHGIILP
TRSPKVAKLYQSIWMDEGSPLMVYSRRQRDKLAELSQRPVELGMTYGEPSLLEGVRKLQQ
QGVEQIVVLPLYPQYSATTTAAVFDGLAKALRQLPVVPELHFIRDYHDHPLYIQALAKSV
RASWQQHGQGDLLLCSYHGIPKRYAQNGDIYPEHCLKTTELLAQALGLPQDKVMMTYQSQ
FGKEEWLQPYTDKTMEALPRQGIKKLDVICPAFSVDCLETLEEIAEQNQEIFLHSGGEAF
HYVPCLNDSQSHIELMAALVKVDC