Protein Info for CSW01_05005 in Vibrio cholerae E7946 ATCC 55056

Annotation: epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF01370: Epimerase" amino acids 3 to 226 (224 residues), 89.9 bits, see alignment E=2.6e-29 TIGR01777: TIGR01777 family protein" amino acids 3 to 295 (293 residues), 345.8 bits, see alignment E=1.2e-107 PF08338: DUF1731" amino acids 253 to 299 (47 residues), 54.8 bits, see alignment 9.1e-19

Best Hits

Swiss-Prot: 44% identical to Y1208_HAEIN: Epimerase family protein HI_1208 (HI_1208) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07071, (no description) (inferred from 100% identity to vcj:VCD_003358)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>CSW01_05005 epimerase (Vibrio cholerae E7946 ATCC 55056)
MRILITGGTGFVGFELIKLLSSHELLVLTRDLTKAAQRFAHIPSQNLQLLRSLDELSDFN
GIDAIINLAGEPIADKRWSKSQKQRIARSRLDITEQLVEKIHASAHPPAVFLSGSAVGFY
GDQQQHAFDESLQVRSDHFSHQVCQQWEQRALKAQSEQTRVCLLRTGIVLAPEGGALKKM
LPPYRLGLGGPIGDGQQYMPWIHMQDMVRAILFLLETEHAQGPYNLCAPHPVTNAEFSLT
LATTLKRPHLFKTPQWLIKMLLGEASELLLDSIRAKPKKLTDLGFQFHYSRIDRAFNQLL
TASQ