Protein Info for CSW01_04995 in Vibrio cholerae E7946 ATCC 55056

Annotation: co-chaperone YbbN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF14559: TPR_19" amino acids 146 to 212 (67 residues), 51.5 bits, see alignment E=1.6e-17 PF14561: TPR_20" amino acids 217 to 306 (90 residues), 94.7 bits, see alignment E=5.1e-31

Best Hits

Swiss-Prot: 43% identical to CNOX_ECOLI: Chaperedoxin (cnoX) from Escherichia coli (strain K12)

KEGG orthology group: K05838, putative thioredoxin (inferred from 100% identity to vco:VC0395_A0498)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>CSW01_04995 co-chaperone YbbN (Vibrio cholerae E7946 ATCC 55056)
MSFEAFIPIVYSAMCHPNQGFAMQAAKIIDVSQHNFHQVLQHSTLSPVLFYFWAPISHES
AELLPAIEQLTERYQGAFVLARLNCQEEQGIAAQFGIQAIPTIALFIEGKPVDGLGGPQP
IEAVEEMLKRHLPSDEERLMYQGFELAEQEQFSEALSLLSTLSDEWRNKGEVKLTLARCY
LETGAVEAAQTELANMPLEYQQGEYKTLIARLELHQQAANSPEIIALEQEWNSDPQNPNI
AIELAKQYHHVKRDEEALSLLWSWLSKNLNTLDGEMKKTFMDILTALGQGHPLANQYRKK
LYSLLY