Protein Info for CSW01_04920 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF01494: FAD_binding_3" amino acids 16 to 324 (309 residues), 103.7 bits, see alignment E=2.5e-33 PF00890: FAD_binding_2" amino acids 17 to 49 (33 residues), 21.9 bits, see alignment 1.9e-08 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 17 to 394 (378 residues), 389.2 bits, see alignment E=9.3e-121 PF01266: DAO" amino acids 17 to 48 (32 residues), 28.2 bits, see alignment (E = 3e-10)

Best Hits

KEGG orthology group: K03184, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [EC: 1.14.13.-] (inferred from 100% identity to vch:VC0963)

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>CSW01_04920 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (Vibrio cholerae E7946 ATCC 55056)
MKRKYWVGKGMSGNKFDILVVGGGMVGAAAALGFARQGRKVAVIDSGAPHAFEPSQPMDV
RVSAISQTSVGLLEELGAWSSVVGMRACPYRHLETWEHPECRTRFSCESLGLPQLGYMVE
NRVIQLALWQQFAAYPQLTLMCPEQLAQLNVSAEGCRVTLQSGAEIECDWVIGADGANSQ
VRNLVRIGVTAWDYRQHCMLINVQTEQIQQETTWQQFFPTGPRSYLPLGGNQASLVWYDT
PQRIRKLSGLNPEQLRSEILQYFPAELGNIKVLQHGAFPLTRRHAQQYVKNRCILIGDAA
HTINPLAGQGVNLGFKDVAVLLAQTQEQALNQASFERYERCRRPDNLLMQTGMDLFYKTF
SNSFTPVRFVRNVALALAERSGPLKTQVLRYALGFSN