Protein Info for CSW01_04860 in Vibrio cholerae E7946 ATCC 55056

Annotation: penicillin-binding protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 21 to 619 (599 residues), 791.4 bits, see alignment E=2.8e-242 PF03717: PBP_dimer" amino acids 65 to 240 (176 residues), 179.3 bits, see alignment E=1.1e-56 PF00905: Transpeptidase" amino acids 272 to 615 (344 residues), 230.9 bits, see alignment E=2.1e-72

Best Hits

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 100% identity to vco:VC0395_A0473)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (638 amino acids)

>CSW01_04860 penicillin-binding protein 2 (Vibrio cholerae E7946 ATCC 55056)
MLRQHTPIRDHQAETHLFRNRAIVSFVGILICMGLLVTNLYNIQINQYQDYKTRSNDNRI
KVVPIAPNRGLIFDRNGVLLAENRPVFNLEVIPEKVPNMEETIARLQQLIEISPEKLAAF
EKERKQTRRFNSVPLLTQLTDDEVAKFSVNQHKFPGVSVTANLKRYYPYGEVLTHVIGYV
SRINDKDLERLDKEGKKANYQATRDIGKLGIERYYEDLLHGTAGYQEVEVNSRGRVIRTL
KYVPPIPGKDIVLNLDIELQLYAYKLLEGRRGSIVALDPKDNGVLAMASSPSYDPNAFVH
GISGKAYSDLLNDKRRPLVNRTTLGIYPPGSTVKPFIAVSALQDGIITPNTTRNDPGYWR
IPNTDTRPFRDWLRWGHGRVDIIKSLEESVDTFFYQIAYDMGIDKLSSWMMRFGFGDLTG
IDIYEESKANMPTREWKMARHKVPWYQGDTIPVGIGQGYWTATPMQIAKATSVLVNHGKV
IAPHLLRATIDNGEQFSTQKETEYTTYPPIDGVPKKYWDMAIHGMYLVNHGAKGTARRAF
QNMPYESAGKSGTAQVFGLAEGQKYNASELAEHLHDHALFTGFAPVKDPKVIVTFVLENG
GGGSSNGAPVVRQIFDHVILGKKEEEPKAESKEEVIQP