Protein Info for CSW01_04820 in Vibrio cholerae E7946 ATCC 55056

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 9 to 385 (377 residues), 590.6 bits, E=1.2e-181
• PF00155: Aminotran_1_2
  • amino acids 82 to 349 (268 residues), 43.7 bits, E=2.2e-15

Best Hits

Swiss-Prot: 100% identical to GLYA1_VIBCH: Serine hydroxymethyltransferase 1 (glyA1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to vco:VC0395_A0465)

MetaCyc: 81% identical to serine hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
4.1.2.-; Glycine hydroxymethyltransferase. [EC: 2.1.2.1]; RXN-6321 [EC: 2.1.2.1]; RXN0-5240 [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations II (plants) (11/11 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• folate polyglutamylation (5/5 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• glycine degradation (3/3 steps found)
• photorespiration II (8/10 steps found)
• folate transformations I (10/13 steps found)
• photorespiration I (7/9 steps found)
• photorespiration III (7/9 steps found)
• glycine biosynthesis I (1/1 steps found)
• glycine betaine degradation III (4/7 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• glycine betaine degradation I (4/8 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Protein Sequence (416 amino acids)

>CSW01_04820 serine hydroxymethyltransferase (Vibrio cholerae E7946 ATCC 55056)
MLKRDMNIADYDPELYAAIQEETLRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYP
GKRYYGGCEYVDKAEALAIDRACQLFGCEYANVQPHSGSQANSAVYMALLNPGDTVLGMS
LAHGGHLTHGSPVNFSGKHYNVIPYGIDEAGQINYDEMEALALEHKPKMIIGGFSAYSQI
VDWKRMREIADKVGAYLFVDMAHVAGLIAAGVYPSPVPFAHVVTTTTHKTLAGPRGGLIL
SNAGEEMYKKLNSAVFPGGQGGPLMHVIAAKAVAFKEAMEPEFKEYQARVVKNAKAMVAQ
FQERGYKIVSNSTENHLFLVDLIDKNITGKEADAALGAANITVNKNSVPNDPRSPFVTSG
IRVGTPAITRRGFTEQDAKDLANWMCDVLDNINDQGVIEATKQKVLAICQRLPVYA