Protein Info for CSW01_04730 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details amino acids 195 to 225 (31 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 363 to 392 (30 residues), see Phobius details signal peptide" amino acids 26 to 28 (3 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC0922)

Predicted SEED Role

"Hypothetical protein VpsF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>CSW01_04730 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MSERNLNRWMILIILSAFLLGAFLLENMGIQYVSEGGSPILKIHVYSYLTMGIFALLILW
VGLFNLIKPLNELKKAWWLAMVSMLAVILYGFMRFGTSGLAYLIDTIFIPLVLVPIVYGL
SDTAKNRLLALLGYLLFLNACIAIIELILAQSIVAVEIGSFSTFRSTAFLAHPLNNALIT
ASLTPIVMRYTRIPVALYVSVIVLALFAFGGRAALGIFLLGNFLMLLPKLRDFLGQGIRY
HKLKFAYLQALVYFSVIAVILTLVLSPIGERILSKLYLDKSAEARFDVFILLEQLSPSEW
VFGASHGLLSDIAFYIGINVVENYLIGWVLNFGLLGAIGLLLATYTVPVRLIYRQELPAQ
VALLSFMLISLTNNALTVKTPALVLFVVALVCRYRSSDRSLASKSH