Protein Info for CSW01_04715 in Vibrio cholerae E7946 ATCC 55056

Annotation: serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF00132: Hexapep" amino acids 115 to 148 (34 residues), 33.9 bits, see alignment 8.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A0443)

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>CSW01_04715 serine acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MSSPWELIKADLYRHTGQVSIGLVVKHLLLNAGFAYMFWFRLCRSKNVLIRTVARLMHRI
LSVRYQIQLPKETQVGPGLYLGHATGVIVNSTAKIGANCNLSPFTVIGSNQGQAATVGDC
VYIGPHVSIVEDITIGDGSIIGAGSVVIRDVPPNSVVVGNPGRVLTRPSHKTYIRHPAPL
ESKS