Protein Info for CSW01_04710 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-N-acetyl-D-mannosamine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 4 to 188 (185 residues), 189.1 bits, E=1.2e-59
• PF03446: NAD_binding_2
  • amino acids 4 to 136 (133 residues), 24 bits, E=6.9e-09
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 4 to 410 (407 residues), 411.8 bits, E=1.4e-127
• PF00984: UDPG_MGDP_dh
  • amino acids 206 to 293 (88 residues), 96.5 bits, E=1.7e-31
• PF03720: UDPG_MGDP_dh_C
  • amino acids 316 to 412 (97 residues), 78.9 bits, E=6.7e-26

Best Hits

Swiss-Prot: 66% identical to EPSD_RALSO: NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase (epsD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02472, UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to vcm:VCM66_0875)

Predicted SEED Role

"UDP-N-acetyl-D-mannosaminuronate dehydrogenase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Protein Sequence (413 amino acids)

>CSW01_04710 UDP-N-acetyl-D-mannosamine dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MFNKVSVIGLGYIGLPTAAVLASRGLDVVGVDVNAHAVDTINKGEIHIVEPDLDIVVRSA
VMTGKLKATLTAEPADAFLVAVPTPFKGDNHEPDLSYIEAAAKTIAPVLAKGNLVVLEST
SPVGTTEKLAQWLAEARPDLTFPQQKGIAADVKIAYCPERVLPGYVLQELVSNDRVIGGV
SKACSEKAVALYKTFVKGECIVTNARTAEMAKLTENSFRDVNIAFANELSLVCNKLKINV
WELIRLANRHPRVSILNPGPGVGGHCIAVDPWFIVNSCPDEAQLIRTAREVNDGKPHWVV
DQVKQAADQFKKPIIACLGLAFKADIDDLRESPALDITKHLAESKVGQLLAVEPNITELP
SKLAKQGIELVSLERALELANIVVVLVDHKEFKAADKTEFAKKVVIDTRGVVA