Protein Info for CSW01_04645 in Vibrio cholerae E7946 ATCC 55056

Annotation: methionine import ATP-binding protein MetN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR02314: D-methionine ABC transporter, ATP-binding protein" amino acids 1 to 343 (343 residues), 692 bits, see alignment E=6.5e-213 PF00005: ABC_tran" amino acids 21 to 169 (149 residues), 126.9 bits, see alignment E=1.4e-40 PF09383: NIL" amino acids 268 to 339 (72 residues), 79.4 bits, see alignment E=2.2e-26

Best Hits

Swiss-Prot: 100% identical to METN_VIBCH: Methionine import ATP-binding protein MetN (metN) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 100% identity to vco:VC0395_A0429)

MetaCyc: 66% identical to L-methionine/D-methionine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>CSW01_04645 methionine import ATP-binding protein MetN (Vibrio cholerae E7946 ATCC 55056)
MIEIKSVNKVFYQGDKQIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSG
QVIVDGVDLTTLSNPQLCAARRNIGMIFQHFNLLSSRTVFENVALPLELAGQSQQHIETK
VTELLALVGLSEKRESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSIL
ELLKEINRQLNLTILLITHEMDVVKSICHEVAIIGGGELVEKGTVGDIFAHPKTELAHQF
IRSTLDLSIPEDYQVRLQPTRVAGSYPLVRLEFTGATVDAPLMTQIARKYNIDVSILSSD
LDYAGGVKFGMMVAEIFGNADDDEAAIRYLRENNVKVEVLGYVL