Protein Info for CSW01_04600 in Vibrio cholerae E7946 ATCC 55056

Annotation: flap endonuclease Xni

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details PF02739: 5_3_exonuc_N" amino acids 29 to 180 (152 residues), 109.9 bits, see alignment E=1.1e-35 PF01367: 5_3_exonuc" amino acids 189 to 280 (92 residues), 83.6 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 100% identical to XNI_VIBCH: Flap endonuclease Xni (xni) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01146, protein Xni (inferred from 99% identity to vcm:VCM66_0855)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>CSW01_04600 flap endonuclease Xni (Vibrio cholerae E7946 ATCC 55056)
MGSNLDGFDYNKGLTSPYFLWFLVMSLHLVIIDALNLIRRVHSAQPDPNDITRTAETTTR
TLQRIINEAQPSHMIAVFDHHLSDRGWRAELLPTYKANRKPMPDVLQQGIDAIQDAWWQL
GIDSLLSEGDEADDLVATLACKVAAHQEKVTIISTDKGYCQLLSPTLQIRDYFQQRWLDE
PFIAQEFGVTPAQLTDYWGLTGVSSSQIPGVAGIGPKAAKEILNQFSSIEEAYASPELPA
KYRKKLDPHIEMARICKQVSALKTDIELGFNLQDIRFNSSSAD