Protein Info for CSW01_04585 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA 4-thiouridine(8) synthase ThiI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 TIGR00342: tRNA sulfurtransferase ThiI" amino acids 4 to 375 (372 residues), 363.4 bits, see alignment E=1.4e-112 PF22025: ThiI_fer" amino acids 10 to 75 (66 residues), 32 bits, see alignment E=3.5e-11 PF02926: THUMP" amino acids 85 to 156 (72 residues), 51.3 bits, see alignment E=3.3e-17 PF02568: ThiI" amino acids 175 to 369 (195 residues), 243.1 bits, see alignment E=4.8e-76 TIGR04271: thiazole biosynthesis domain" amino acids 382 to 483 (102 residues), 131.9 bits, see alignment E=7.9e-43 PF00581: Rhodanese" amino acids 399 to 481 (83 residues), 26.9 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 100% identical to THII_VIBCH: tRNA sulfurtransferase (thiI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03151, thiamine biosynthesis protein ThiI (inferred from 100% identity to vch:VC0894)

MetaCyc: 65% identical to tRNA uridine 4-sulfurtransferase (Escherichia coli K-12 substr. MG1655)
tRNA sulfurtransferase. [EC: 2.8.1.4]; 2.8.1.- [EC: 2.8.1.4]

Predicted SEED Role

"tRNA S(4)U 4-thiouridine synthase (former ThiI) / Rhodanese-like domain required for thiamine synthesis" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>CSW01_04585 tRNA 4-thiouridine(8) synthase ThiI (Vibrio cholerae E7946 ATCC 55056)
MKFIVKPHPEIFVKSESVRKRFTKILESNIRIIVKARTQGVAVFNRRDHIEVTSNSDTYY
AEVLEILTTTPGIQQVLEVQQSSFTDLHNIYEQVLELNRANLENKTFVVRAKRRGKHDFT
SIELERYVGGGLNQAIASAKVKLINPDVTVQVEVVDELLNQVIARHKGLGGFPLGTQEDV
LSLISGGFDSGVSSYLHIKRGSKVHYCFFNLGGPAHEIGVKQTAYYLWQKYGSSAKVRFI
AIDFAPVVAEILEKIDDGQMGVVLKRMFMRTAGMVAEKFGIQALVTGEALGQVSSQTLTN
LRHIDNVTDTLILRPLINWDKEDIIRLAREIGTEDFAKTMPEFCGVISKSPTVKAVKEKL
EEEEAKFDFALLDQVVYNARQIDIRDIGKESLEKAPEVELVNSAEEGNAVVLDIRSPDEE
DESPLEIVGVEVKHLPFYKLATQFGDLDQSKTYLLYCSRGVMSRLQALYLQEQGFNNVKV
YRP