Protein Info for CSW01_04565 in Vibrio cholerae E7946 ATCC 55056

Annotation: (2E,6E)-farnesyl diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF00348: polyprenyl_synt" amino acids 31 to 269 (239 residues), 203.3 bits, see alignment E=1.9e-64

Best Hits

Swiss-Prot: 59% identical to ISPA_ECOLI: Farnesyl diphosphate synthase (ispA) from Escherichia coli (strain K12)

KEGG orthology group: K00795, farnesyl diphosphate synthase [EC: 2.5.1.1 2.5.1.10] (inferred from 100% identity to vcm:VCM66_0847)

MetaCyc: 59% identical to geranyl diphosphate/farnesyl diphosphate synthase (Escherichia coli K-12 substr. MG1655)
Geranyltranstransferase. [EC: 2.5.1.10]; Dimethylallyltranstransferase. [EC: 2.5.1.10, 2.5.1.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.1 or 2.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>CSW01_04565 (2E,6E)-farnesyl diphosphate synthase (Vibrio cholerae E7946 ATCC 55056)
MIEALSSYQQRNNQQLDQWLNRIPFQTLPLIEAMRYGLLLGGKRARPYLVYITGQMLGCE
LSDLDTPASAVECIHAYSLIHDDLPAMDDDELRRGKPTCHIQFDEATAILTGDALQTLAF
TILAEGDLSAAGETQRVAMLQALAEASGAQGMCLGQALDLAAENRLISLEELETIHRNKT
GALMRCAIRLGALAAGEKGRAMLPHLDRYAEAVGLAFQVQDDILDIISDTETLGKPQGSD
QELNKSTYPALLGLEGAQQKAHTLLQEALLALEAIPYNTEHLEEFARYVVERKN