Protein Info for CSW01_04410 in Vibrio cholerae E7946 ATCC 55056

Annotation: molecular chaperone DnaK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 TIGR02350: chaperone protein DnaK" amino acids 3 to 602 (600 residues), 953.6 bits, see alignment E=1.9e-291 PF00012: HSP70" amino acids 4 to 601 (598 residues), 888.1 bits, see alignment E=2.6e-271 PF06723: MreB_Mbl" amino acids 115 to 375 (261 residues), 45.6 bits, see alignment E=4.6e-16

Best Hits

Swiss-Prot: 100% identical to DNAK_VIBC3: Chaperone protein DnaK (dnaK) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K04043, molecular chaperone DnaK (inferred from 100% identity to vcj:VCD_003472)

MetaCyc: 84% identical to chaperone protein DnaK (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Chaperone protein DnaK" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (635 amino acids)

>CSW01_04410 molecular chaperone DnaK (Vibrio cholerae E7946 ATCC 55056)
MGKIIGIDLGTTNSCVAVLDGDKPRVIENAEGERTTPSVIAYTDGETLVGQPAKRQAVTN
PQNTLFAIKRLIGRRFEDEEVQRDIKIMPYKIVKADNGDAWVEAKGQKMAAPQVSAEVLK
KMKKTAEDFLGEPVTAAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGL
DKQGGDRTIAVYDLGGGTFDISIIEIDEVEGEKTFEVLSTNGDTHLGGEDFDNRMINYLV
DEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVT
RAKLEALVEDLVQRSLEPLKVALADADLSVNDITDVILVGGQTRMPMVQKKVAEFFGKEP
RKDVNPDEAVAVGAAVQGGVLAGEVKDVLLLDVTPLSLGIETMGGVMTKLIEKNTTIPTK
ANQVFSTAEDNQSAVTIHVLQGERKQAMYNKSLGQFNLEGINPAPRGMPQIEVIFDLDAD
GILHVSAKDKQTGKEQKITIQASGGLSDAEIEKMVQEAEANKEADKKFEELATARNQADQ
MIHATRKQITEAGEALPADEKAKIETAINELETAKKGEDKAEIDAKVQALMAAAQKLMEI
AQQQAQAQGANAGQSSAKEDDVVDAEFEEVNDDKK