Protein Info for CSW01_04110 in Vibrio cholerae E7946 ATCC 55056

Annotation: citrate:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 427 to 447 (21 residues), see Phobius details PF03390: 2HCT" amino acids 25 to 442 (418 residues), 518.8 bits, see alignment E=4.5e-160

Best Hits

Swiss-Prot: 70% identical to CITN_KLEPN: Citrate-sodium symporter (citS) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 100% identity to vch:VC0795)

MetaCyc: 100% identical to citrate:Na+ symporter (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-501

Predicted SEED Role

"Na(+)Citrate OH(-) antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>CSW01_04110 citrate:sodium symporter (Vibrio cholerae E7946 ATCC 55056)
MNEKTLHLDKKSAVVGGLNLSQTKIFGTPLPLFLFLLLTVLAAHFTDTLPSGLVGGFAFM
FVIGAIFGEVGKRLPIFNKYIGGAPVMIFLVAAWFVHMGWLSDREIKTVTEVMDKSKFLD
LFIAVLITGSILAVNRKLLIRSLAGYIPTILAAVAGAAVFGIAIGLVFGITPDRIMMLYV
LPIMGGGNGAGAIPLSEIYESVTGGSKEQYYSVAIAILTIANIVAIVAAAVINIIGEKIP
SLTGNGELVRSSKLDVSEEAKNLTVTHREIAIGLMLAACVYTFSYALSKEILPGFGSIQI
HTFAYMVVIIAILNAAGLCSDEIKEGAKRLSNFFSKQMLWLLMVGVGIAYTDLAEIINAL
TFANVIIATVIVLGAIIGAALGGWAMGFYPVEASITAGLCMANRGGSGDLEVLAASNRMS
LLSYAQISSRLGGGIVLVIASVVFGMFV