Protein Info for CSW01_04105 in Vibrio cholerae E7946 ATCC 55056

Annotation: sodium pump decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details TIGR01195: sodium pump decarboxylases, gamma subunit" amino acids 54 to 137 (84 residues), 104 bits, see alignment E=2.4e-34 PF04277: OAD_gamma" amino acids 58 to 132 (75 residues), 78.8 bits, see alignment E=2e-26

Best Hits

KEGG orthology group: K01573, oxaloacetate decarboxylase, gamma subunit [EC: 4.1.1.3] (inferred from 100% identity to vch:VC0794)

Predicted SEED Role

"Oxaloacetate decarboxylase gamma chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>CSW01_04105 sodium pump decarboxylase (Vibrio cholerae E7946 ATCC 55056)
MAALCWSSPASYSECLFNPLTLAPWDYLARLARLFFSPFSTLFLPLEVTMQSTSLFLEGI
NLLTLGMGFVFIFLIFLVYATRAMSQLIVRFAPPEVPAKTTNKKASANKAKANPNQNQGE
LLAVLTAAVHHHKTQQKLS