Protein Info for CSW01_04065 in Vibrio cholerae E7946 ATCC 55056

Annotation: D-amino acid dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00890: FAD_binding_2" amino acids 4 to 46 (43 residues), 21.3 bits, see alignment 5.6e-08 PF01266: DAO" amino acids 4 to 398 (395 residues), 277.2 bits, see alignment E=1.1e-85 PF00070: Pyr_redox" amino acids 4 to 35 (32 residues), 22.2 bits, see alignment (E = 6.5e-08) PF02558: ApbA" amino acids 4 to 37 (34 residues), 26.5 bits, see alignment 1.8e-09 PF13450: NAD_binding_8" amino acids 6 to 35 (30 residues), 28.8 bits, see alignment (E = 4.9e-10)

Best Hits

Swiss-Prot: 100% identical to DADA_VIBCH: D-amino acid dehydrogenase (dadA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 100% identity to vcj:VCD_003540)

MetaCyc: 54% identical to D-amino acid dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN-11193 [EC: 1.4.5.1]; 1.4.5.- [EC: 1.4.5.1]

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.5.1 or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>CSW01_04065 D-amino acid dehydrogenase small subunit (Vibrio cholerae E7946 ATCC 55056)
MMEVLVLGSGVVGLTSAWYLAQAGHDVTVVDRQPRGAEETSFANAGQISYGYSSPWAAPG
IPQKALKWMLEKHAPLKIQPSLDPALLSWMGKMLLNCQLSRYQVNKSRMLAIANYSRECL
KALNQTYSLDYQGRQRGTLQVFRDEKQLTAIEKDMQLLAQSGVRFELLNVAQCLTHEPGL
APVQEKLVGGLWLPDDETGDCYLFCQQLTELAKQQGVRFHFDCHIQQLVCEGKKIIGVQT
DLGLLKADAYVVALGSYSTSLLKPLGIEIPVYPVKGYSLTLPIIDEKFAPQSTVMDETYK
VALTRFSDRIRVAGTAELAGFDPAIPEARKATIEMVARDLFPHGGDFAKGQFWTGFRPMT
PDGTPIIGATPYTNLYTNTGHGTLGWTMACGSASILADVLTHGESPLSRLGLDLFRYPKA
S