Protein Info for CSW01_04060 in Vibrio cholerae E7946 ATCC 55056

Annotation: alanine:cation symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details amino acids 426 to 451 (26 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 462 (450 residues), 447.7 bits, see alignment E=2e-138 PF01235: Na_Ala_symp" amino acids 50 to 472 (423 residues), 498.1 bits, see alignment E=1.2e-153

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to vcm:VCM66_0742)

Predicted SEED Role

"Sodium/alanine symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>CSW01_04060 alanine:cation symporter family protein (Vibrio cholerae E7946 ATCC 55056)
MQSFVDFLNGIIWSPALIYLCLGAGLFYSVLTRFVQVRHFFEMWRLLLNNKESSKGISSF
QALAVSLSGRVGTGNIAGVAAAIGFGGPGAVFWMWMVAFFGAATAYAESTLAQIYKEEDN
GEFRGGPAYYIEKAMGQKWYAWVFAIATIFACGVLLPGVQSNSIGNAVESAFGSGPMIET
ALGTFSFAKIFTGTVISILLGFIIFGGVKRIASFTQIVVPFMALAYIITAFVIILLNIGE
VPRIIAMIVGDAFSPMAGVGAAIGWGVKRGVYSNEAGQGTGPHAAAAASVEHPAQQGLVQ
SFSIYIDTLMVCSATAFMILITGAYNVHGAAEGMFLVQNLPADIIASSPAFTQIAVDSAL
PGIGKPFVAFALFFFAFTTILAYYYIAETNVAYIRRTFKVDGLMFVLKLVLMASVFYGTV
KTANLAWALGDVGVGLMAWLNIVGIIIIFFMSKPTMAALKDYEDQQKQGVTEFTFNPVKL
GIKGATYWEGKYLRKTGKAPTAEVKETQRVEQTSSL