Protein Info for CSW01_04045 in Vibrio cholerae E7946 ATCC 55056

Annotation: vibriobactin biosynthesis 4'-phosphopantetheinyl transferase VibD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17837: 4PPT_N
  • amino acids 67 to 129 (63 residues), 72.7 bits, E=2e-24
• PF01648: ACPS
  • amino acids 136 to 219 (84 residues), 49.3 bits, E=4.8e-17

Best Hits

KEGG orthology group: K02362, enterobactin synthetase component D [EC: 2.7.8.-] (inferred from 100% identity to vcm:VCM66_0738)

MetaCyc: 100% identical to VibD phosphopantetheinyl transferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Holo-[acyl-carrier-protein] synthase. [EC: 2.7.8.7]; RXN-10988 [EC: 2.7.8.7]

Predicted SEED Role

"Phosphopantetheinyl transferase component of siderophore synthetase (EC 2.7.8.-)" in subsystem Iron acquisition in Vibrio (EC 2.7.8.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• acyl carrier protein metabolism (2/2 steps found)
• acyl carrier protein activation (1/1 steps found)
• enterobactin biosynthesis (7/11 steps found)
• petrobactin biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Pantothenate and CoA biosynthesis
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-, 2.7.8.7

Use Curated BLAST to search for 2.7.8.- or 2.7.8.7

Protein Sequence (261 amino acids)

>CSW01_04045 vibriobactin biosynthesis 4'-phosphopantetheinyl transferase VibD (Vibrio cholerae E7946 ATCC 55056)
MCRYARSYLLHAFDYTLFVKARLNMAFMISMPAIELAGLTIQVCQFDPQQFDEDQQHYLA
PPTYHSLHKAVVKRQAEFVAGRKLAQQALKQIGQGYDRPIAIGTHREPLWPAGITGSIAH
CDGWAVCTVLKAEHLSLGIDIEHRLAHQTASEVQAIIGTAQEWALLAQQFDLASAVTLLF
SAKESLFKALFPQVHLYLDFCDAQLSSLEPNKMSFTLTRVPNAAQQSCEVYFRWFEQQRV
LTVSVLPMLGKIEYHVPTLPT