Protein Info for CSW01_04000 in Vibrio cholerae E7946 ATCC 55056

Annotation: isochorismatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 30 to 200 (171 residues), 134.5 bits, E=4.4e-43
• PF00550: PP-binding
  • amino acids 224 to 279 (56 residues), 33.3 bits, E=4.6e-12

Best Hits

Swiss-Prot: 100% identical to VIBB_VIBCH: Vibriobactin-specific isochorismatase (vibB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04777, vibriobactin-specific isochorismatase [EC: 3.3.2.1] (inferred from 100% identity to vcm:VCM66_0729)

MetaCyc: 100% identical to vibriobactin biosynthesis bifunctional isochorismatase/aryl carrier protein VibB (Vibrio cholerae)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1) of siderophore biosynthesis" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Iron acquisition in Vibrio or NAD and NADP cofactor biosynthesis global (EC 3.3.2.1)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• 2,3-dihydroxybenzoate biosynthesis (3/3 steps found)
• vibriobactin biosynthesis (6/9 steps found)
• enterobactin biosynthesis (7/11 steps found)
• bacillibactin biosynthesis (6/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of siderophore group nonribosomal peptides

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.2.1

Protein Sequence (293 amino acids)

>CSW01_04000 isochorismatase (Vibrio cholerae E7946 ATCC 55056)
MAIPKIASYPLPVSLPTNKVDWRIDASRAVLLIHDMQEYFVHYFDSQAEPIPSLIKHIQQ
LKAHAKQAGIPVVYTAQPANQDPAERALLSDFWGPGLSEETAIIAPLAPESGDVQLTKWR
YSAFKKSPLLDWLRETGRDQLIITGVYAHIGILSTALDAFMFDIQPFVIGDGVADFSLSD
HEFSLRYISGRTGAVKSTQQACLEIAAQHSKLTGLSLRTMQHDVAAALNLSVDEVDVQEN
LLFLGLDSIRAIQLLEKWKAQGADISFAQLMEHVTLQQWWQTIQANLHQPCSA