Protein Info for CSW01_03955 in Vibrio cholerae E7946 ATCC 55056

Annotation: outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 8 to 382 (375 residues), 456.3 bits, see alignment E=3.2e-141 PF13360: PQQ_2" amino acids 75 to 311 (237 residues), 194.8 bits, see alignment E=3.8e-61 amino acids 296 to 379 (84 residues), 22.8 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 100% identical to BAMB_VIBCH: Outer membrane protein assembly factor BamB (bamB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vch:VC0762)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>CSW01_03955 outer membrane protein assembly factor BamB (Vibrio cholerae E7946 ATCC 55056)
MKKLFNQVLVAAGVLALLAGCASEEENVIMAPLPIVKSEFTPKTLWSASVGDGVGHYFSK
LAPDYAYDKVFVASRDGVVKALDPQNGKVIWTTDLEIEGSARLSGGITAAFGKLFIGSEN
GVVNALDAETGEPLWASAIEGEVLAAPAADNNIVIVNTSRGALIALNQEDGAQKWTISTE
VPNLTLRGDSRPTAVAGGVFWGTPSGRLAAAIAERGQLIWQQPVGQPKGATEIDRLVDVD
ASPLVIGGTLFTVGFNGQLIAIDLRSGQPIWKRNYSSATDMATDGSRLYLVTDKDHLVAV
DTRSGTELWSNTQLEHRLLTAPKMIDDYLVVGDAEGYLHWIDRNSGEFIAQQLVNDSGFA
VGPLALNDGYVIVTRNGQIKKLTIQQ