Protein Info for CSW01_03890 in Vibrio cholerae E7946 ATCC 55056

Annotation: Fe-S cluster assembly scaffold IscU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 87% identical to ISCU_ECOL6: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 100% identity to vcj:VCD_003577)

MetaCyc: 87% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

[2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>CSW01_03890 Fe-S cluster assembly scaffold IscU (Vibrio cholerae E7946 ATCC 55056)
MAYSEKVIDHYENPRNVGSFDKEDPSVGSGMVGAPACGDVMRLQIKVSPEGIIEDAKFKT
YGCGSAIASSSLVTEWVKGKSIDEAAAIKNSEIAEELELPPVKIHCSILAEDAIKAAVAD
YKKKHQH