Protein Info for CSW01_03835 in Vibrio cholerae E7946 ATCC 55056

Annotation: acetoin utilization protein AcuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF00571: CBS" amino acids 24 to 78 (55 residues), 51.5 bits, see alignment E=5.2e-18 amino acids 99 to 148 (50 residues), 39.6 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: None (inferred from 99% identity to vco:VC0395_A0268)

Predicted SEED Role

"Putative acetoin utilization protein AcuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>CSW01_03835 acetoin utilization protein AcuB (Vibrio cholerae E7946 ATCC 55056)
MGKGVRDPGSDGSLRRKELAMIKVEDMMTRHPHTLLRTHTLNDAKHLMEALDIRHVPIVD
ANKKLLGIVSQRDLLAAQESSLQRSAQGDSLAFETPLFEVMHTDVTSVAPQAGLKESAIY
MQKHKIGCLPVVAKDVLVGIITDSDFVTIAINLLELQEESEPDELDEEQ