Protein Info for CSW01_03805 in Vibrio cholerae E7946 ATCC 55056

Annotation: polyphosphate kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF03976: PPK2" amino acids 3 to 230 (228 residues), 388.3 bits, see alignment E=6.1e-121 TIGR03707: polyphosphate kinase 2" amino acids 3 to 230 (228 residues), 384.7 bits, see alignment E=7.8e-120

Best Hits

Swiss-Prot: 66% identical to PK21B_PSEAE: Polyphosphate:ADP phosphotransferase (PA2428) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_003596)

Predicted SEED Role

"Polyphosphate kinase 2 (EC 2.7.4.1)" (EC 2.7.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.1

Use Curated BLAST to search for 2.7.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>CSW01_03805 polyphosphate kinase 2 (Vibrio cholerae E7946 ATCC 55056)
MAKLDKKVYERELELLQIELVKLQEWVKQEKLKLVVIFEGRDAAGKGGVIKTITEKLNPR
VCRVAALPAPTEKEKTQWYFQRYVAHLPAGGEIVLFDRSWYNRAGVEKVMGFCSDEEYQE
FLRSCPEFERMLQRSGIILLKYWFSVSDEEQERRFIERINTPLKRWKFSPMDLESRQRWA
AYSRAKDEMFAYTDTKHCPWWVVPSDDKKRARLNCISHLLSSVEYQEIEHAPITLPEINK
QGYVRPPIEDQTFVPQRY