Protein Info for CSW01_03785 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 731 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 436 to 459 (24 residues), see Phobius details amino acids 471 to 492 (22 residues), see Phobius details amino acids 499 to 520 (22 residues), see Phobius details amino acids 533 to 553 (21 residues), see Phobius details amino acids 583 to 606 (24 residues), see Phobius details amino acids 627 to 648 (22 residues), see Phobius details amino acids 696 to 719 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 449 to 725 (277 residues), 35 bits, see alignment E=6.2e-13

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to vcm:VCM66_0682)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (731 amino acids)

>CSW01_03785 phosphate ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MVRQPFSLKERDRARLVKDRVVRFAVTCGGVSVLGALVLIFIYLAMVVVPLFGDAKWRGD
IAVKTVSTTDPLLMTIGAYGENAFLMSNDGVGQFWSLRSVSDQPIQTQSLGFTPVLWAQT
PPAQGWFALVGQDNQVAVVHPQLSHSMTTQGREFTPSLERLALPEAFRLSEQPLQQFAFA
LTAEALIFATYDNAQQIQILRLDRATQQEISRLSLSVPFSDLSQLLLTPDGKTLYLRTRS
ELVVALLDKQSYQIREIVDLSEGDSRHQVTQLYLLSGAFSLLAVHEDGLVSQWFDVLRDG
QRHLNHIRNFKLASEVQFLLPDTNTKGFYSFYRNGTLQSHYTTSEKLVLFERAYQRAPQL
VAMSENQAYLASYDQGKIRLAQVENRNPEVSFSALWQKVWYESYPEPEFVWQSTAATDDF
EAKFSLVPIAFGTLKAAAFAMLFAMPIAVLGAIYTAYFMTPSMRRVVKPTIELMEALPTV
IIGFLAGLWFAPFVESHLPAVLALMILLPPSTIVLGFIWSRLPKAWLRRIPSGWHALILI
PVLIGISALILSYSGELENALFAGDLRVYLAQHGIGYDQRNALVVGFAMGFAVIPTIFTI
AEDAIFSVPKHLSDGSLALGATPWQTLIYVVLLTASPGIFSAIMMGLGRAVGETMIVLMA
TGNTPLLDWNIFEGMRTLSATIAVELPESEVQSAHFRILFLAALLLLTFTFAVNSLAEWV
RQRLREKYRSL