Protein Info for CSW01_03765 in Vibrio cholerae E7946 ATCC 55056

Annotation: two-component system sensor histidine kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 16 to 45 (30 residues), see Phobius details PF11808: PhoR" amino acids 7 to 91 (85 residues), 105.9 bits, see alignment E=2.9e-34 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 94 to 424 (331 residues), 452.1 bits, see alignment E=1.1e-139 PF00989: PAS" amino acids 99 to 157 (59 residues), 32.9 bits, see alignment E=1.4e-11 PF13188: PAS_8" amino acids 99 to 158 (60 residues), 27.8 bits, see alignment E=4.2e-10 TIGR00229: PAS domain S-box protein" amino acids 99 to 203 (105 residues), 23.3 bits, see alignment E=5.8e-09 PF00512: HisKA" amino acids 205 to 271 (67 residues), 66.7 bits, see alignment E=3.7e-22 PF02518: HATPase_c" amino acids 318 to 428 (111 residues), 92.8 bits, see alignment E=4.7e-30

Best Hits

Swiss-Prot: 59% identical to PHOR_KLEPN: Phosphate regulon sensor protein PhoR (phoR) from Klebsiella pneumoniae

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to vch:VC0720)

MetaCyc: 60% identical to sensor histidine kinase PhoR (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>CSW01_03765 two-component system sensor histidine kinase PhoR (Vibrio cholerae E7946 ATCC 55056)
MVERLTWKKLAWELAFFYLPWVVVGWIFGSMPWLLLAATALQLFWHLNHQIRLSAWLWDE
KRLTPPSGTGNWESLFNGIYRLQQRHRKKRKELTNLIRRFRNGAESLPDAVVVFRSEGNI
VWCNRLAQHLLGFRWPDDAGQPISNLLRTPDFIKYLKKDDFTDPLEMRSPLNSDRMLELR
IVPYTEGEHLMVVRDVTQLKQLEGMRRNFFANVSHELRTPMTVLQGYLEMTEDPDVLAGP
MWSKAHGVMTEQLNRMNGLVNQLLTLSKIEASPMVELDQVVDVPAMLEVLEKEAVSLSGE
AQHKLHFEVDKSLKVLADEDQLRSAISNLVYNAVKYTPPGAQIDVRWYRTGKGACLEVED
KGEGIEPQHLHRLTERFYRVDKARSRDTGGSGLGLAIVKHALAHHDTHLDIYSKVGVGSK
FSFVLPKRLVAKG