Protein Info for CSW01_03670 in Vibrio cholerae E7946 ATCC 55056

Annotation: biofilm architecture maintenance protein MbaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 260 to 280 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 338 to 506 (169 residues), 112.7 bits, see alignment E=7.5e-37 PF00990: GGDEF" amino acids 340 to 503 (164 residues), 130.1 bits, see alignment E=6.9e-42 PF00563: EAL" amino acids 523 to 754 (232 residues), 216.1 bits, see alignment E=4.7e-68

Best Hits

Swiss-Prot: 100% identical to MBAA_VIBCH: Biofilm architecture maintenance protein MbaA (mbaA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vch:VC0703)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (791 amino acids)

>CSW01_03670 biofilm architecture maintenance protein MbaA (Vibrio cholerae E7946 ATCC 55056)
MKLNHRILLLIAPVILLSAAASSYIIYTSQKNALLKRTDSYLQLNIEKLASHYRQAQSLV
SSYAFTLAKSDIIRHYFSLEKNPYRELELVDNLRETLQILQPNEKQLVSLSILNGHEELL
YYAENSSDPFAELDPKVMAYIKQRFASTQKNSDISYTVNSAGEDILVRYDMLDTQTLSTP
LSYNRQDVFFVVVYVVLEQFSQLRKKIEFDNQSPIFFTHSPPSYRTGLLQSVELQPGFYA
ILDPAPKLINAQLHSIQRELLLSFGVSALVTVLMLLLLLYRHVINPILHLDKQLEEVENN
QRKNIEKLNTDDEIGRLSSRFYAMYSELHSTYQRTKALAENDHLTKLANRYQFQVQADLL
LSRCYDTQHIWVMYIDLDNFKYVNDKYGHQIGDSLLVSFATHVRQLCKNFEASHNTYSIA
ARLSGDEFAILLVSPKRFNDCAKIFAQRLLAPIQNKDNSPLSHFPITASIGIATFPKDGE
HIEKLLLNADTAMYQAKNAGKNQVAYYSQALDQIVQRRNNIERALRLGLFDQEFNLAYQP
YFTCSGKRLVGFEVLLRWQSELLGEVSPEEFIPIAEQTGLFGTIDRWVISKAFQEISTLQ
AIVKEPIQVSINLSSAELNSLKLAQFIHRQAEQFGVSPAWIDFEITETFAADSQSFPLLH
ELSRLGYGLTIDDFGSGYTSITQLVQYPVQKIKFDRHFLDTLIATNKQNVIRPLIDLCHS
QSMKVTAEGIESETMHQWLADYECDYMQGFYFGYPMSLSEISPWLHASNHKKKSYAQDHY
CFTEPSQSECR